PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK28029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 83aa    MW: 9125.75 Da    PI: 9.8744
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK28029.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.85.9e-191764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +lv++v+++G g+W+++ +  g+ R++k+c++rw ++l
        PK28029.1 17 KGPWTTSEDAILVEYVRKHGEGNWNAVQKNSGLARCGKSCRLRWANHL 64
                     79******************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.6911268IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-221563IPR009057Homeodomain-like
SMARTSM007174.2E-141666IPR001005SANT/Myb domain
PfamPF002494.5E-171764IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-201882IPR009057Homeodomain-like
CDDcd001678.13E-111964No hitNo description
Gene3DG3DSA:1.10.10.601.1E-46482IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
XEEDGPGGSR GGAGLKKGPW TTSEDAILVE YVRKHGEGNW NAVQKNSGLA RCGKSCRLRW  60
ANHLRPNLKK GSFSPDEERI IIX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-161182171B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077993.12e-41myb domain protein 101
SwissprotA2WW871e-38GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC21e-38GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA8MSC32e-41A8MSC3_ARATH; Myb domain protein 101
STRINGAT2G32460.12e-40(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.26e-39myb domain protein 101